PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi02g05560.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family LBD
Protein Properties Length: 205aa    MW: 22204.2 Da    PI: 5.1996
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi02g05560.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.31.1e-42381371100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l+a+l
  Vradi02g05560.1  38 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVTSMVYEASARIRDPVYGCAGAICQLQKQVNELQAQL 131
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a+ ++e
  Vradi02g05560.1 132 AKSQAE 137
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.37937138IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4238135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MESSDTYTPT SSAPLSHSPT SSSSSPPPPP PPTVVMSPCA ACKILRRRCA EKCVLAPYFP  60
PTEPAKFTIA HRVFGASNII KFLQELPESQ RADAVTSMVY EASARIRDPV YGCAGAICQL  120
QKQVNELQAQ LAKSQAELVT MQLQQANLVA LICMEMAQSP QESPQQSVDN FISTPPHTGG  180
YQSGMNNFFE DNTSPNALWE PLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971750.0BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492929.11e-150PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9SK082e-77LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0S3SCU31e-148A0A0S3SCU3_PHAAN; Uncharacterized protein
TrEMBLA0A0L9V6W41e-148A0A0L9V6W4_PHAAN; Uncharacterized protein
STRINGGLYMA11G15810.11e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.18e-78LOB domain-containing protein 11